PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590507.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 270aa    MW: 30848.3 Da    PI: 5.157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590507.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013590507.1 16 RGPWSPEEDLKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding53.74.8e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e ++++++ +G++ W++Ia++++ gRt++++k+ w+++l
   XP_013590507.1  69 RGNFSAEEEEMIIKLHQSYGNK-WSKIASKLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.4111163IPR017930Myb domain
SuperFamilySSF466892.82E-3014110IPR009057Homeodomain-like
SMARTSM007172.4E-131565IPR001005SANT/Myb domain
PfamPF002494.3E-151663IPR001005SANT/Myb domain
CDDcd001671.65E-91863No hitNo description
PROSITE profilePS5129426.19164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2867119IPR009057Homeodomain-like
SMARTSM007177.3E-1668116IPR001005SANT/Myb domain
PfamPF002492.1E-1569114IPR001005SANT/Myb domain
CDDcd001677.55E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS PEEDLKLISF IQKFGHENWR SLPKQSGLLR CGKSCRLRWI  60
NYLRPDVKRG NFSAEEEEMI IKLHQSYGNK WSKIASKLPG RTDNEIKNVW HTHLKKRLVK  120
SSASPDEPAS PCSSDKTQAE DCLNIKTTHD STTSGSSGGS NNSNQEDDPN MGLMFEYSQF  180
NDIIEEVDKP DLLEIPFDSD LDIWSFLDGP NENSSVSRGE EECDEDEVKK WLKHLENELG  240
LEEEDNHQHH KEGAQDKDSS LLKTYELMIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892090.0AC189209.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB007M04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590507.10.0PREDICTED: myb-related protein Zm1
SwissprotP200241e-69MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0D3D1R90.0A0A0D3D1R9_BRAOL; Uncharacterized protein
STRINGBra035097.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-123myb domain protein 63